PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011088154.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 321aa    MW: 35116.7 Da    PI: 7.8776
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011088154.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF732.5e-232369349
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     en+sn qvtfskRr+g++KKA+EL++LC+ae+a+i+fs+ +k+y +
  XP_011088154.1 23 MENESNLQVTFSKRRAGLFKKASELCTLCGAEAAIIVFSPADKVYCF 69
                    69******************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.7871373IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-311372IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-251483IPR002100Transcription factor, MADS-box
CDDcd002653.20E-311481No hitNo description
PRINTSPR004041.3E-171535IPR002100Transcription factor, MADS-box
PfamPF003192.3E-242269IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-173550IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-175071IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MSSSNQAPPK KSKGRQKVNM VKMENESNLQ VTFSKRRAGL FKKASELCTL CGAEAAIIVF  60
SPADKVYCFG HPNVKLVLDR FAAGVAPTTA NDQLIFEAHR NSTIRELNLE LTQVESMLRA  120
ERMHGEEIDL IRKAGQMQNW FPDSFDEFNF AQLCGLKEFI TSFKKDFDVK MQKDMRSLAE  180
QLPSYYPPPA GKMENHRGFH LGVDADIGPP LNAQLSLGTN AVSPYAHGGI EFRNSGLSAH  240
GETHGSSLAK VSNDPMTTSN TSALISCDYL RANTSLSGNV FFADGHGRSS SNLPIDPTTI  300
GSRDVNNASC GFNIGFGPRL F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088154.10.0PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A022RB356e-66A0A022RB35_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20424223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-53AGAMOUS-like 62